PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA21753
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 395aa    MW: 44737 Da    PI: 8.8732
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA21753genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.2e-31101154255
                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                prlrWtp+LH +Fv+a+e+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Tp57577_TGAC_v2_mRNA21753 101 PRLRWTPDLHLSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 154
                                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-2997155IPR009057Homeodomain-like
PROSITE profilePS5129411.03297157IPR017930Myb domain
SuperFamilySSF466893.76E-1499155IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-22101156IPR006447Myb domain, plants
PfamPF002493.8E-8102153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MAETIGISSE DIKIEGSGVI RAKPSLLGRR KRSFFDLNEE AVDDIGDDDE ILISDGLCGE  60
ISTNNEISSQ SQEGNLSSNN NSSEEKGRGS SVRQYVRSKM PRLRWTPDLH LSFVHAIERL  120
GGQERATPKL VLQLMNVRGL SIAHVKSHLQ MYRSKKLDES GQVLSQKNRA MQGRNHHILD  180
MYGRFNVQGQ FGVNNNYLQP SSQLMKQPYN EIKTHATSRF HENGVFNNNH VILRSSSVWD  240
KDLYKTSSHI FDVKDAITRN NIGPINSSQI FQLLPEEKKW PPQGSENHIS LSRDEQHFPW  300
SSYSSPIFTK VHDKKDGMQE FIHQTQVLKQ GHVTVQLKRL NEKKENSPSF LELKLSRDSE  360
INVKDQTNID LKGEQEAHTI LSLSLFSSSS SNSR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004487568.11e-176PREDICTED: putative two-component response regulator ARR21
TrEMBLA0A072VAU21e-169A0A072VAU2_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA12G33911.11e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-37G2-like family protein